PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof018786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 152aa    MW: 15744.6 Da    PI: 9.7067
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17326643PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12.1e-1381125147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I +++g  +t  q++s+ qky
        Sof018786  81 RESWTEPEHDKFLEALQLFDRD-WKKIEAYVG-SKTVIQIRSHAQKY 125
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-1675130IPR009057Homeodomain-like
PROSITE profilePS5129414.1776130IPR017930Myb domain
TIGRFAMsTIGR015573.1E-1979128IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.1E-680121IPR009057Homeodomain-like
SMARTSM007172.7E-1080128IPR001005SANT/Myb domain
PfamPF002493.4E-1181125IPR001005SANT/Myb domain
CDDcd001673.28E-783126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MSTTPKPLDS AAVSAGAGAG GGGGGDEGGG GGGGGGGKKQ VRGAAAAAVM APPPMAVPAA  60
APAAGEEVRK VRKPYTITKS RESWTEPEHD KFLEALQLFD RDWKKIEAYV GSKTVIQIRS  120
HAQKYFLKVX KNGTGEHSLL CEPERAVAHL YL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.160270.0crown| leaf| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656359.15e-57PREDICTED: protein REVEILLE 6-like isoform X3
RefseqXP_006656360.15e-57PREDICTED: protein REVEILLE 6-like isoform X4
RefseqXP_015693738.14e-57PREDICTED: protein REVEILLE 6-like isoform X2
SwissprotQ8H0W32e-45RVE6_ARATH; Protein REVEILLE 6
TrEMBLJ3MGQ66e-57J3MGQ6_ORYBR; Uncharacterized protein
STRINGOB06G32000.12e-56(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.12e-45MYB_related family protein